| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334669.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| LHHHHLPPSNTNTVIMPESLPSFSSSVKLKYVKQGYQYLVNHILTFTLIPIIVAVAVQLLRLGPNEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTCRVP FSTFMEHSRLILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMESARGEAEVVIFSSIDSLMQKTGIRAKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNIKSFNLSGMGCS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 15,694.317 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.481 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.858 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.274 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334669.1 | 5prime_partial | 135 | 3-410(+) |
Amino Acid sequence : | |||
| PPPPPSTLKYKHRHHAGIPPQFLQLRQAQVCKTRLPIPCQPHPHLHSHPHHRRRRRPAPPIRPQRNARHLELSPIGRSPPPLLLLPRRLRRHRLLHVQAEVDLPRGLRLLQAACHVPRPL LHLHGAFPPHSQRQP* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,694.317 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.481 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.858 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.274 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334669.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| LHHHHLPPSNTNTVIMPESLPSFSSSVKLKYVKQGYQYLVNHILTFTLIPIIVAVAVQLLRLGPNEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTCRVP FSTFMEHSRLILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMESARGEAEVVIFSSIDSLMQKTGIRAKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNIKSFNLSGMGCS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 15,694.317 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.481 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.858 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.274 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334669.1 | 5prime_partial | 135 | 3-410(+) |
Amino Acid sequence : | |||
| PPPPPSTLKYKHRHHAGIPPQFLQLRQAQVCKTRLPIPCQPHPHLHSHPHHRRRRRPAPPIRPQRNARHLELSPIGRSPPPLLLLPRRLRRHRLLHVQAEVDLPRGLRLLQAACHVPRPL LHLHGAFPPHSQRQP* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,694.317 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.481 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.858 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.274 | ||
| sheet | 0.230 | ||