Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334677.1 | 5prime_partial | 214 | 744-100(-) |
Amino Acid sequence : | |||
EDRYDFDPVDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYD PTRHAEQFPIPPVVLKGKRDKACIEKENNFKQPGERYRSFEPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNVRPTM* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 14,207.627 | ||
Theoretical pI: | 9.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 42.804 | ||
aromaticity | 0.048 | ||
GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.218 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334677.1 | 3prime_partial | 124 | 373-744(+) |
Amino Acid sequence : | |||
MTGRIIPRWEIVHLLIPMHEVHETFMVIVVMSTLGSISWELQIVRSKTVPLSIRVRKDSSLEQLVIRIVNPRNNKSRAKCELFILRKEVVNVLVQHQTTNGLQGDDVLGPSLCNINWVEV ISVF | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,207.627 | ||
Theoretical pI: | 9.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 42.804 | ||
aromaticity | 0.048 | ||
GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.218 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334677.1 | 5prime_partial | 214 | 744-100(-) |
Amino Acid sequence : | |||
EDRYDFDPVDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYD PTRHAEQFPIPPVVLKGKRDKACIEKENNFKQPGERYRSFEPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNVRPTM* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 14,207.627 | ||
Theoretical pI: | 9.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 42.804 | ||
aromaticity | 0.048 | ||
GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.218 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334677.1 | 3prime_partial | 124 | 373-744(+) |
Amino Acid sequence : | |||
MTGRIIPRWEIVHLLIPMHEVHETFMVIVVMSTLGSISWELQIVRSKTVPLSIRVRKDSSLEQLVIRIVNPRNNKSRAKCELFILRKEVVNVLVQHQTTNGLQGDDVLGPSLCNINWVEV ISVF | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,207.627 | ||
Theoretical pI: | 9.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 42.804 | ||
aromaticity | 0.048 | ||
GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.218 | ||
sheet | 0.210 |