Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334680.1	5prime_partial	152	1-459(+)
Amino Acid sequence :
PQLKFTPTTMAIAFKMATTGMRVTDECKNSFMEMKWKKVHRYIVFKIDEGSKRLTVDKVGAAAEGYKDLAAALPHDDCRYAVFDFDFVTVDNCHKSKIFFIAWAPTASRIRAKILYATSK DGLRRALDGIHYELQATDPTEMGFDIIQDRVK*
Physicochemical properties
Number of amino acids:		152
Molecular weight:		17,320.866
Theoretical pI:		8.977
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		30.571
aromaticity		0.112
GRAVY		-0.264
Secondary Structure Fraction
Helix		0.289
turn		0.125
sheet		0.243