| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334685.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| RKSHVRRQCVRLITVLSAAHGDALSPHVSRMISVVLRRLRDPDSAVQSACVDAVASVAAHVSSAPFTVIMKPLVDTLFQEQDMKPQIGAALCVAAAVEAAAEPDLAELRKLLPRALKFVK SDSCKGKAALLSLLGSIVRSDCVKSKNLLSSMVSTAVELLSSEDWAARKEAADVLEKVAVSCTSLAAEMKPCAVAALESRRFDKVKLVREKMNRVLEIWKDLPTQSEVESES | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 18,001.286 | ||
| Theoretical pI: | 9.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 33.566 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.285 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334685.1 | 5prime_partial | 172 | 695-177(-) |
Amino Acid sequence : | |||
| LSDSTSDWVGRSFHISSTLFIFSLTSFTLSNLLLSRAATAQGFISAAKLVQDTATFSKTSAASFLAAQSSLLNNSTAVDTIELNKFLLLTQSLLTILPNSDSKAALPLQLSLLTNFKALG RSFLSSAKSGSAAASTAAATQRAAPIWGFISCSWKSVSTSGFMMTVNGAELT* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,001.286 | ||
| Theoretical pI: | 9.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 33.566 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.285 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334685.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| RKSHVRRQCVRLITVLSAAHGDALSPHVSRMISVVLRRLRDPDSAVQSACVDAVASVAAHVSSAPFTVIMKPLVDTLFQEQDMKPQIGAALCVAAAVEAAAEPDLAELRKLLPRALKFVK SDSCKGKAALLSLLGSIVRSDCVKSKNLLSSMVSTAVELLSSEDWAARKEAADVLEKVAVSCTSLAAEMKPCAVAALESRRFDKVKLVREKMNRVLEIWKDLPTQSEVESES | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 18,001.286 | ||
| Theoretical pI: | 9.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 33.566 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.285 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334685.1 | 5prime_partial | 172 | 695-177(-) |
Amino Acid sequence : | |||
| LSDSTSDWVGRSFHISSTLFIFSLTSFTLSNLLLSRAATAQGFISAAKLVQDTATFSKTSAASFLAAQSSLLNNSTAVDTIELNKFLLLTQSLLTILPNSDSKAALPLQLSLLTNFKALG RSFLSSAKSGSAAASTAAATQRAAPIWGFISCSWKSVSTSGFMMTVNGAELT* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,001.286 | ||
| Theoretical pI: | 9.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 33.566 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.285 | ||
| sheet | 0.314 | ||