Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334696.1 | complete | 133 | 127-528(+) |
Amino Acid sequence : | |||
MSGKGAKGLLTGKTPASKDKDKKKPTSRSSRAGLQFPVGRIHRLLKERVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIP HIHKSLINKSSKE* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,362.439 | ||
Theoretical pI: | 9.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 58.495 | ||
aromaticity | 0.095 | ||
GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.241 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334696.1 | complete | 116 | 675-325(-) |
Amino Acid sequence : | |||
MKYYVHIACPSRNTIVTKSTHNQLFSLHNMPQIELLKCGQPNPRASKNILFLGGLVDERLMYMRDHTTTSNGSFYEGVKFLIPAYRQLKMPWRDTLHFQILAGISSQLQHLSSKVL* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,362.439 | ||
Theoretical pI: | 9.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 58.495 | ||
aromaticity | 0.095 | ||
GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.241 | ||
sheet | 0.233 |