| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334696.1 | complete | 133 | 127-528(+) |
Amino Acid sequence : | |||
| MSGKGAKGLLTGKTPASKDKDKKKPTSRSSRAGLQFPVGRIHRLLKERVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIP HIHKSLINKSSKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 13,362.439 | ||
| Theoretical pI: | 9.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 58.495 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.241 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334696.1 | complete | 116 | 675-325(-) |
Amino Acid sequence : | |||
| MKYYVHIACPSRNTIVTKSTHNQLFSLHNMPQIELLKCGQPNPRASKNILFLGGLVDERLMYMRDHTTTSNGSFYEGVKFLIPAYRQLKMPWRDTLHFQILAGISSQLQHLSSKVL* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,362.439 | ||
| Theoretical pI: | 9.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 58.495 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.241 | ||
| sheet | 0.233 | ||