Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334703.1 | 5prime_partial | 200 | 2-604(+) |
Amino Acid sequence : | |||
YKKTLKVLFFAFSLVHSLHERKTSHHNNFTNKTYHTHREISDSQKYVKNTCPHILKSKPHIKSMLNYYSSNSSKPTQCDSQGDNGKLAQSLASPSTPEKPNASGSTPPGPYGTPPQPQPS TRRAPREKHRRPPSSQSWGSKTQHTHTPAGGTRPPACHSASSTLPRYGTLSSPNYPLLSTLLRRCSLFLMGRNQPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 12,355.473 | ||
Theoretical pI: | 11.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 61.728 | ||
aromaticity | 0.067 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.210 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334703.1 | 5prime_partial | 178 | 746-210(-) |
Amino Acid sequence : | |||
SIPFSSDKLPEIYTKFSVEPDSDEAEAMKKPIQECEEKGIKGEEKVCATSLESMVDFAPSKIGNNVEAVSTEADSSERKVYRIEGVSRKPSDKPVVVCPQQEYEYAVFYSPKTETTVAYD VSLVGPGGSKAEAVAVCHRDPAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 12,355.473 | ||
Theoretical pI: | 11.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 61.728 | ||
aromaticity | 0.067 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.210 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334703.1 | complete | 105 | 252-569(+) |
Amino Acid sequence : | |||
MANWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLRPAGPHERNIVGHRRLSLGGVKHSILILLLGAHDHRLVTRLPRHSLDTVHFPLRTIRFCRHCFDVVPYF* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,355.473 | ||
Theoretical pI: | 11.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 61.728 | ||
aromaticity | 0.067 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.210 | ||
sheet | 0.238 |