| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334716.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| TPVKTRKMPSSNGVDSFQELLDAQAHIWNHMFNYINSMALKWAVQLGIPDIIHRHDKPMTLSQLANAIPINRAKSDALHRIMRILVHSKFFDRVRTLSNEEEAYCLTRASRLLLRDEPLS LAPYALAVLDEDLMGIFHCVPQWFGNECPSPLEFKHGKSIREFAENKQRWSLLFNEGMANDARLVGSILAKESRKVFEGLETMVDVGGGTGMVAKAIVDAFPGMKGIVLDLPYVVSGLKG SKNLRYVGGDMFQS | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 12,079.839 | ||
| Theoretical pI: | 8.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.370 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.384 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334716.1 | 5prime_partial | 112 | 762-424(-) |
Amino Acid sequence : | |||
| DWNMSPPTYLKFLDPFNPETTYGRSSTIPFMPGKASTMALATIPVPPPTSTIVSNPSKTFLLSLASILPTNLASFAIPSLKSRLHLCLFSANSLILFPCLNSSGEGHSFPNH* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,079.839 | ||
| Theoretical pI: | 8.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.370 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.384 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334716.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| TPVKTRKMPSSNGVDSFQELLDAQAHIWNHMFNYINSMALKWAVQLGIPDIIHRHDKPMTLSQLANAIPINRAKSDALHRIMRILVHSKFFDRVRTLSNEEEAYCLTRASRLLLRDEPLS LAPYALAVLDEDLMGIFHCVPQWFGNECPSPLEFKHGKSIREFAENKQRWSLLFNEGMANDARLVGSILAKESRKVFEGLETMVDVGGGTGMVAKAIVDAFPGMKGIVLDLPYVVSGLKG SKNLRYVGGDMFQS | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 12,079.839 | ||
| Theoretical pI: | 8.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.370 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.384 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334716.1 | 5prime_partial | 112 | 762-424(-) |
Amino Acid sequence : | |||
| DWNMSPPTYLKFLDPFNPETTYGRSSTIPFMPGKASTMALATIPVPPPTSTIVSNPSKTFLLSLASILPTNLASFAIPSLKSRLHLCLFSANSLILFPCLNSSGEGHSFPNH* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,079.839 | ||
| Theoretical pI: | 8.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 55.370 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.384 | ||
| sheet | 0.241 | ||