| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334721.1 | complete | 203 | 33-644(+) |
Amino Acid sequence : | |||
| MFARRDTTSTCLTWLFWLLSRNPTAFLKIREEIERELNLKQEEKWRSFTAAESNKLKYLHGALCESLRLFPPVPFEHKSPIKPDRLPSGQYLRKNSKLIVCFYSLGRMESVWGKDCLEFK PERWISLKGGIKHEPSYKFPAFNAGPRTCLGKEMAFVQMKMVAATIIHHYNVTLVEGHPVYPSDSIILQAKHGLRITLSRAHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 16,305.835 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 57.621 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.162 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334721.1 | complete | 136 | 608-198(-) |
Amino Acid sequence : | |||
| MLSLQDNGVARINWMTFHKCHVVMMNYCCRHHLHLYERHFFAQTSPGTGVERRKLVRWLVLDPPFQRNPSLRLEFQAIFPPHRLHPPQRIETDYQLGVFAKVLAAGEAVRLDRRFVLEWD RREQPQRLTQRPVKIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 16,305.835 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 57.621 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.162 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334721.1 | complete | 203 | 33-644(+) |
Amino Acid sequence : | |||
| MFARRDTTSTCLTWLFWLLSRNPTAFLKIREEIERELNLKQEEKWRSFTAAESNKLKYLHGALCESLRLFPPVPFEHKSPIKPDRLPSGQYLRKNSKLIVCFYSLGRMESVWGKDCLEFK PERWISLKGGIKHEPSYKFPAFNAGPRTCLGKEMAFVQMKMVAATIIHHYNVTLVEGHPVYPSDSIILQAKHGLRITLSRAHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 16,305.835 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 57.621 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.162 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334721.1 | complete | 136 | 608-198(-) |
Amino Acid sequence : | |||
| MLSLQDNGVARINWMTFHKCHVVMMNYCCRHHLHLYERHFFAQTSPGTGVERRKLVRWLVLDPPFQRNPSLRLEFQAIFPPHRLHPPQRIETDYQLGVFAKVLAAGEAVRLDRRFVLEWD RREQPQRLTQRPVKIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 16,305.835 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 57.621 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.162 | ||
| sheet | 0.250 | ||