| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| APRSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLVTTTTH | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
| HHVPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | 5prime_partial | 159 | 765-286(-) |
Amino Acid sequence : | |||
| VGRSCYQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHD PVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
| TTFLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| APRSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLVTTTTH | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
| HHVPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | 5prime_partial | 159 | 765-286(-) |
Amino Acid sequence : | |||
| VGRSCYQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHD PVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334729.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
| TTFLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,586.798 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.602 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.233 | ||
| sheet | 0.217 | ||