Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
APRSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLVTTTTH | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
HHVPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | 5prime_partial | 159 | 765-286(-) |
Amino Acid sequence : | |||
VGRSCYQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHD PVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
TTFLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
APRSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLVTTTTH | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
HHVPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | 5prime_partial | 159 | 765-286(-) |
Amino Acid sequence : | |||
VGRSCYQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHD PVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334729.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
TTFLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,586.798 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.602 | ||
aromaticity | 0.025 | ||
GRAVY | -1.483 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.233 | ||
sheet | 0.217 |