| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334730.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| KTSLAPGSGVVTKYLLQSGLQKYLNKQGFHIVGYGCTTCIGNSGDLDESVSSAIADNDLVAAAVLSGNRNFEGRVHPLTRANYLASPPLVMAYALAGTVDIDFEKEPIGIGKDGENVYFR DIWPSSQEIAQVVQSSVLPEMFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKDAYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFN SYGSRRGNDEVMARGTFA | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,096.224 | ||
| Theoretical pI: | 5.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
| Instability index: | 41.158 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.326 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.298 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334730.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| KTSLAPGSGVVTKYLLQSGLQKYLNKQGFHIVGYGCTTCIGNSGDLDESVSSAIADNDLVAAAVLSGNRNFEGRVHPLTRANYLASPPLVMAYALAGTVDIDFEKEPIGIGKDGENVYFR DIWPSSQEIAQVVQSSVLPEMFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKDAYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFN SYGSRRGNDEVMARGTFA | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,096.224 | ||
| Theoretical pI: | 5.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
| Instability index: | 41.158 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.326 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.298 | ||
| sheet | 0.221 | ||