Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334733.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
ARRIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRP MKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSIINMDADVITIENS RSDEKLLSVFREGVKYGAGIGPGVYD | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 11,748.274 | ||
Theoretical pI: | 10.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 101.398 | ||
aromaticity | 0.038 | ||
GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.279 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334733.1 | 5prime_partial | 104 | 2-316(+) |
Amino Acid sequence : | |||
HAVLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAVLSHQSSTVMSVAQSQ* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,748.274 | ||
Theoretical pI: | 10.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 101.398 | ||
aromaticity | 0.038 | ||
GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.279 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334733.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
ARRIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRP MKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSIINMDADVITIENS RSDEKLLSVFREGVKYGAGIGPGVYD | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 11,748.274 | ||
Theoretical pI: | 10.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 101.398 | ||
aromaticity | 0.038 | ||
GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.279 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334733.1 | 5prime_partial | 104 | 2-316(+) |
Amino Acid sequence : | |||
HAVLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAVLSHQSSTVMSVAQSQ* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,748.274 | ||
Theoretical pI: | 10.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 101.398 | ||
aromaticity | 0.038 | ||
GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.279 | ||
sheet | 0.250 |