Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334735.1 | 5prime_partial | 235 | 3-710(+) |
Amino Acid sequence : | |||
TRFRSNPMQAALAVMAAHTVLTAVVVAPVTHQPFLFPTISSTSSPSISSHSSFHGVALKSNVRPFLSLSAAAAPKPLTVSASAKKAVAVLKGTSTVEGVVTLTQEGDGPTTLSVRITGLT PGKHGFHLHEFGDTTNGCISTGPHFNPNGLTHGAPEDDVRHAGDLGNIVANAEGVAEAKIVDNQIPLSGPNSVVGRAFVVHELEDDLGKGGHELSLSTGNAGGRLACGVVGLTPL* | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 12,489.017 | ||
Theoretical pI: | 5.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 38.745 | ||
aromaticity | 0.052 | ||
GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.181 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334735.1 | 3prime_partial | 116 | 349-2(-) |
Amino Acid sequence : | |||
MRTLKVVGPSPSCVRVTTPSTVEVPLSTATAFLAEAETVRGLGAAAAERDRNGRTFDLRATPWKEEWEEIEGEEVEEIVGKRKGWWVTGATTTAVRTVCAAITASAACIGLDRNRV | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,489.017 | ||
Theoretical pI: | 5.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 38.745 | ||
aromaticity | 0.052 | ||
GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.181 | ||
sheet | 0.310 |