| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334749.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| ASAAPFLAPDFDKCGPVSDANSGQLLEGVDCCLITEEIADYKLPPSVMKFRPPAHRVTPEYVAKYNLAIKRMKELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPF HRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQVVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHT SIHIFVGDSRQPRKENMGNFYSA | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 14,658.958 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 32.934 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.246 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334749.1 | 5prime_partial | 138 | 790-374(-) |
Amino Acid sequence : | |||
| RGVEVAHVLFPRLAAVSDEDVDRGVGPALGGSGAGAHRSSKAVRLSHEIEHIVVSSDHFGVHDGEIVGHDLQRVGAAGTSEVDDGGEVSRLAFLVVDWRTYDVEHRRDCHSFRVVPVPEG EGEGGIADQLAQNPLVEV* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,658.958 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 32.934 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.246 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334749.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| ASAAPFLAPDFDKCGPVSDANSGQLLEGVDCCLITEEIADYKLPPSVMKFRPPAHRVTPEYVAKYNLAIKRMKELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPF HRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQVVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHT SIHIFVGDSRQPRKENMGNFYSA | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 14,658.958 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 32.934 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.246 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334749.1 | 5prime_partial | 138 | 790-374(-) |
Amino Acid sequence : | |||
| RGVEVAHVLFPRLAAVSDEDVDRGVGPALGGSGAGAHRSSKAVRLSHEIEHIVVSSDHFGVHDGEIVGHDLQRVGAAGTSEVDDGGEVSRLAFLVVDWRTYDVEHRRDCHSFRVVPVPEG EGEGGIADQLAQNPLVEV* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,658.958 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 32.934 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.246 | ||
| sheet | 0.239 | ||