Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334754.1 | 5prime_partial | 168 | 729-223(-) |
Amino Acid sequence : | |||
KEKLKRNIEIVPPLKKDDGGGDKKEKEGGGGDKKEGGAKKEKEVKKEGGGEKKEEKKEGSGDKKPAGGGGEGSKGVEGPKVEVNKLEYHSLNPQTHYANAMPMYNQNYYNQDYGLALHQY QSYPPNHGYGNTSYVVQYAPGPPPPPPTYLNVNDHMFSDENPNGCSVM* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 13,177.805 | ||
Theoretical pI: | 6.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 45.042 | ||
aromaticity | 0.221 | ||
GRAVY | 1.587 | ||
Secondary Structure Fraction | |||
Helix | 0.602 | ||
turn | 0.142 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334754.1 | complete | 113 | 349-690(+) |
Amino Acid sequence : | |||
MVWRVTLILVECETVILIVIILVVHWHRIGVVCLWIQTMVLQFVYFHFWPLHAFAPFSSSTSRFLITAALFFLLLFLSSPFFLDFLFFLGSSFFLVPSTTFFFLLVSATVVFL* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,177.805 | ||
Theoretical pI: | 6.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 45.042 | ||
aromaticity | 0.221 | ||
GRAVY | 1.587 | ||
Secondary Structure Fraction | |||
Helix | 0.602 | ||
turn | 0.142 | ||
sheet | 0.257 |