| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334755.1 | 3prime_partial | 245 | 30-764(+) |
Amino Acid sequence : | |||
| MANNTNPWVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFKYPFGI SGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATVFGVTE FIXPK | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 12,939.901 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.621 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.289 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334755.1 | 3prime_partial | 121 | 364-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTQGFVLFAMVDILYLNG V | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,939.901 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.621 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.289 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334755.1 | 3prime_partial | 245 | 30-764(+) |
Amino Acid sequence : | |||
| MANNTNPWVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFKYPFGI SGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATVFGVTE FIXPK | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 12,939.901 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.621 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.289 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334755.1 | 3prime_partial | 121 | 364-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTQGFVLFAMVDILYLNG V | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,939.901 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.621 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.289 | ||
| sheet | 0.215 | ||