| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334759.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
| KAFAAGIILATGFMHVLPDSFDMLSSACLKENPWHKFPFTGFVAMLSAIITLMIDSMATSLYSKKNKGGIQPESGGGIEMAAVEAGGGFGHAHNHGGKMEIEGSQLLRYRVIAMVRSYYN SLLVFNYFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,013.105 | ||
| Theoretical pI: | 7.148 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 58.526 | ||
| aromaticity | 0.116 | ||
| GRAVY | 0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.271 | ||
| sheet | 0.302 | ||