Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334759.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
KAFAAGIILATGFMHVLPDSFDMLSSACLKENPWHKFPFTGFVAMLSAIITLMIDSMATSLYSKKNKGGIQPESGGGIEMAAVEAGGGFGHAHNHGGKMEIEGSQLLRYRVIAMVRSYYN SLLVFNYFE* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,013.105 | ||
Theoretical pI: | 7.148 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 58.526 | ||
aromaticity | 0.116 | ||
GRAVY | 0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.271 | ||
sheet | 0.302 |