| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334770.1 | 5prime_partial | 192 | 585-7(-) |
Amino Acid sequence : | |||
| EQTKVVNSITVLSTELLKPRHQQYKNKEVLFNSNRLIANEKSSAVGSARKFGGLKISGLLQQIPLVVFQSHLDRVRSKSICDSQQYVLQLILELLVIHLAAVVAVELREDRVVELRELLR RRGDVDAEVALDEAHRLEGAAELRSGKDAVVVEVERRESRVDALLELRVVLHEGADRCTVDYDYAHFLIVFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 12,042.475 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 117.282 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.279 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334770.1 | 5prime_partial | 148 | 1-447(+) |
Amino Acid sequence : | |||
| ARLYKHNQKMGVVIIDGTTVRSFVEDDAQFQKSVDAAFAALDLNNDGVLSRSELRRAFESMRLIESHFGVDVATPPEELTKLYDSIFAKFDCDNSGEVDHKEFKDELKNILLAIADGLGS NPIQMALEDDERNLLKQAADLEASKFSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,042.475 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 117.282 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.279 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334770.1 | 5prime_partial | 104 | 3-317(+) |
Amino Acid sequence : | |||
| TPIQTQSENGRSHNRRYNGPLLRGGRRAVPEERRRGFRGARPQQRRRPFPIGAPPRLRVDAPHREPLRRRRRHAAGGAHEALRLDLREVRLRQQRRGGSQGVQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,042.475 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 117.282 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.279 | ||
| sheet | 0.212 | ||