| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334774.1 | 5prime_partial | 158 | 2-478(+) |
Amino Acid sequence : | |||
| VYILSEKPKMAEQLFEEQIAEFKEAFNLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMT NLGEKLTDDEVEEMIKEADVDGDGQVNYEEFVRMMLAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 18,048.010 | ||
| Theoretical pI: | 4.224 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 29.986 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.599 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.152 | ||
| sheet | 0.354 | ||