Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334774.1 | 5prime_partial | 158 | 2-478(+) |
Amino Acid sequence : | |||
VYILSEKPKMAEQLFEEQIAEFKEAFNLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMT NLGEKLTDDEVEEMIKEADVDGDGQVNYEEFVRMMLAK* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 18,048.010 | ||
Theoretical pI: | 4.224 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 29.986 | ||
aromaticity | 0.076 | ||
GRAVY | -0.599 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.152 | ||
sheet | 0.354 |