Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334781.1 | 5prime_partial | 150 | 2-454(+) |
Amino Acid sequence : | |||
HAVNPDDGKILAMDITLENYELGLPVIEKAGVAHKIDFREGPALPVLDQMVADGKYEGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVL ELNKALAADPRIEICQLPVGDGITLCRRII* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,788.112 | ||
Theoretical pI: | 5.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 36.380 | ||
aromaticity | 0.093 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.200 | ||
sheet | 0.253 |