| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334787.1 | complete | 113 | 40-381(+) |
Amino Acid sequence : | |||
| MLCAAQTKAIAERTSDWTNVVLAYEPVWAIGTGKVATPSQAQEVHFELRKWLQANVNAEVASSTRIIYGGSVNGGNCKELAGQTDVDGFLVGGASLKPEFIDIIKAAETKKSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,010.484 | ||
| Theoretical pI: | 5.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 13.963 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.221 | ||
| sheet | 0.283 | ||