Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334789.1	complete	179	155-694(+)
Amino Acid sequence :
MDRWSMPMISRAAYLCLILVFARFLRGSTNVEGDALNTLKSNLADPNNVLQSWDPTLVNPCTWFHVTCDSDNLVTRVDLGNANLSGQLVPQLGQLPYLQYLELYSNNISGKIPPELGNLT NLVSLDLYLNKLTGPIPDTLYKLQKLRFLRLNNNSLTGQIPVSLTTISTLQVLYVGRCQ*
Physicochemical properties
Number of amino acids:		179
Molecular weight:		19,997.871
Theoretical pI:		7.631
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 27180
Instability index:		30.517
aromaticity		0.078
GRAVY		0.023
Secondary Structure Fraction
Helix		0.374
turn		0.285
sheet		0.257