| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334799.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
| FLFDEVFCMYAEGEPTDTQFGLDLLEAIKTEVGVRPSRKSLDFLLSACTNAQDANTSFLIWKEYERAGLPYNVLSFVRMYQALLASGDQKSAAKLLSKIPKDDGHVRCVLRACHQKYVKG ESVKTRKKKALLATLGVLESLEAKTE* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,324.670 | ||
| Theoretical pI: | 8.344 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 33.116 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.171 | ||
| sheet | 0.322 | ||