Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334799.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
FLFDEVFCMYAEGEPTDTQFGLDLLEAIKTEVGVRPSRKSLDFLLSACTNAQDANTSFLIWKEYERAGLPYNVLSFVRMYQALLASGDQKSAAKLLSKIPKDDGHVRCVLRACHQKYVKG ESVKTRKKKALLATLGVLESLEAKTE* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,324.670 | ||
Theoretical pI: | 8.344 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 33.116 | ||
aromaticity | 0.089 | ||
GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.171 | ||
sheet | 0.322 |