| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334816.1 | 3prime_partial | 237 | 53-763(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFKYPFGI SGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATVFG | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 13,875.988 | ||
| Theoretical pI: | 7.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 50.460 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.271 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334816.1 | 3prime_partial | 129 | 387-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMDDILYLSL VPIRHETAC | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,875.988 | ||
| Theoretical pI: | 7.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 50.460 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.271 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334816.1 | 3prime_partial | 237 | 53-763(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFKYPFGI SGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATVFG | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 13,875.988 | ||
| Theoretical pI: | 7.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 50.460 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.271 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334816.1 | 3prime_partial | 129 | 387-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMDDILYLSL VPIRHETAC | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,875.988 | ||
| Theoretical pI: | 7.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 50.460 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.271 | ||
| sheet | 0.233 | ||