Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334819.1 | 5prime_partial | 103 | 508-197(-) |
Amino Acid sequence : | |||
KIPTMSAATKGGWVVAATIGAVEALKDQLGVCRWNYVFRSLEQRARNRVQSYYHTHVSPPPAAAAAGRMKRMMGAEGERIDIREMRVKKMMDISCWGPTTVRF* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,555.399 | ||
Theoretical pI: | 10.279 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 49.723 | ||
aromaticity | 0.078 | ||
GRAVY | -0.309 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.194 | ||
sheet | 0.272 |