| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334865.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| VDIEDQGFLKQLDTFICRLVMESRRSANYQASIWDDNFIQSLASPYAGEKYVEKAEKLKTEVTTMIDQTRDELKQLELIDNLQRLGICHHFQDLIKKILQKFYGEERNGDHQHYREKGLH FTALRFRILRQNGYPVPQDVFSSFMNKAGDFEESLSKDTKGLVSLYEASYLSMEGETILDMAKDFSSHHLHKMVEDATDKRVANQIIHSLEMPLHQRVQKLEAIWFIQFYECGSDANPTL VELAKLDFNMVQATYQDE | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 30,096.705 | ||
| Theoretical pI: | 5.324 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 44.458 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.159 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334865.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| VDIEDQGFLKQLDTFICRLVMESRRSANYQASIWDDNFIQSLASPYAGEKYVEKAEKLKTEVTTMIDQTRDELKQLELIDNLQRLGICHHFQDLIKKILQKFYGEERNGDHQHYREKGLH FTALRFRILRQNGYPVPQDVFSSFMNKAGDFEESLSKDTKGLVSLYEASYLSMEGETILDMAKDFSSHHLHKMVEDATDKRVANQIIHSLEMPLHQRVQKLEAIWFIQFYECGSDANPTL VELAKLDFNMVQATYQDE | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 30,096.705 | ||
| Theoretical pI: | 5.324 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 44.458 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.159 | ||
| sheet | 0.279 | ||