| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334879.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
| APRLVPNSARGQSVTTLEIARYWKQRHMLEEDHLIAAIKAAARLRSRNFSESDYLRFEKSLMEAENDDGVLEGKCRSKAERRIGVKDWWTKSKYAYLNQPAVVKTDHHYYRAPPSHLHLP RCLLLLSNS* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,974.917 | ||
| Theoretical pI: | 9.611 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 51.616 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.687 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.202 | ||
| sheet | 0.302 | ||