Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334879.1	5prime_partial	129	1-390(+)
Amino Acid sequence :
APRLVPNSARGQSVTTLEIARYWKQRHMLEEDHLIAAIKAAARLRSRNFSESDYLRFEKSLMEAENDDGVLEGKCRSKAERRIGVKDWWTKSKYAYLNQPAVVKTDHHYYRAPPSHLHLP RCLLLLSNS*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		14,974.917
Theoretical pI:		9.611
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25565
Instability index:		51.616
aromaticity		0.085
GRAVY		-0.687
Secondary Structure Fraction
Helix		0.279
turn		0.202
sheet		0.302