| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334921.1 | 5prime_partial | 239 | 820-101(-) |
Amino Acid sequence : | |||
| HKIGHTAQCVCLVDEMGNRTMRPCLSTAVKVQGDDLTTSDLRGSKWLVMRYGIFNMEVIQTAIKIAKQEGVSVSLDLASFEMVRKFRLPLLQLLESGGIDMCFANEDEAAELLSSEDKAC PESALDFLAKHCRWAVVTLGSKGCIARHGKEVVRTPAIGESKAVDATGAGDLFASGFLYGLVKGLTLEECCKIGSCSGGSVIRSLGGEVTPENWHWMYKQMQAKGLPIPHPTNFVYDKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 25,988.769 | ||
| Theoretical pI: | 6.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28585 | ||
| Instability index: | 30.254 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.226 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334921.1 | 5prime_partial | 239 | 820-101(-) |
Amino Acid sequence : | |||
| HKIGHTAQCVCLVDEMGNRTMRPCLSTAVKVQGDDLTTSDLRGSKWLVMRYGIFNMEVIQTAIKIAKQEGVSVSLDLASFEMVRKFRLPLLQLLESGGIDMCFANEDEAAELLSSEDKAC PESALDFLAKHCRWAVVTLGSKGCIARHGKEVVRTPAIGESKAVDATGAGDLFASGFLYGLVKGLTLEECCKIGSCSGGSVIRSLGGEVTPENWHWMYKQMQAKGLPIPHPTNFVYDKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 25,988.769 | ||
| Theoretical pI: | 6.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28585 | ||
| Instability index: | 30.254 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.226 | ||
| sheet | 0.280 | ||