| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334929.1 | 5prime_partial | 207 | 721-98(-) |
Amino Acid sequence : | |||
| RGEDWWSDPAYGYHMKAFTNAMIAHVRLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWRDDKCI EILKKCKEAIPGSPGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKFIESVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 18,429.771 | ||
| Theoretical pI: | 11.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 88.129 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.776 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.235 | ||
| sheet | 0.131 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334929.1 | complete | 153 | 179-640(+) |
Amino Acid sequence : | |||
| MHPFLISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTPWNRFFAFLQNFYAFIVPPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 18,429.771 | ||
| Theoretical pI: | 11.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 88.129 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.776 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.235 | ||
| sheet | 0.131 | ||