| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334930.1 | internal | 279 | 3-839(+) |
Amino Acid sequence : | |||
| TTILIIIFLIPIFLLNSSFYLAKMHSLNSTALDLKSLIRPPPIHHRLAAAPRLIQCASRFDSTNVNSSFNPATTTGLSLGSGQVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVN GHPTLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLP VHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLN | |||
Physicochemical properties | |||
| Number of amino acids: | 279 | ||
| Molecular weight: | 20,539.307 | ||
| Theoretical pI: | 11.343 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 54.685 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.507 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.164 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334930.1 | complete | 183 | 662-111(-) |
Amino Acid sequence : | |||
| MNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTSGGFTVRAGDALVSDAQLRAVHRRRREVGDAERLRERRRRRRVRLLLDWDYVKCRVTVDDGDAVGALLGVLLLRLHL AGEYRARALPFVTRAAYLTGAEAQTGGGGGVETGIDVGGVETRGALDETRSGGEAVVDRRRPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 20,539.307 | ||
| Theoretical pI: | 11.343 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 54.685 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.507 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.164 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334930.1 | internal | 279 | 3-839(+) |
Amino Acid sequence : | |||
| TTILIIIFLIPIFLLNSSFYLAKMHSLNSTALDLKSLIRPPPIHHRLAAAPRLIQCASRFDSTNVNSSFNPATTTGLSLGSGQVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVN GHPTLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLP VHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLN | |||
Physicochemical properties | |||
| Number of amino acids: | 279 | ||
| Molecular weight: | 20,539.307 | ||
| Theoretical pI: | 11.343 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 54.685 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.507 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.164 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334930.1 | complete | 183 | 662-111(-) |
Amino Acid sequence : | |||
| MNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTSGGFTVRAGDALVSDAQLRAVHRRRREVGDAERLRERRRRRRVRLLLDWDYVKCRVTVDDGDAVGALLGVLLLRLHL AGEYRARALPFVTRAAYLTGAEAQTGGGGGVETGIDVGGVETRGALDETRSGGEAVVDRRRPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 20,539.307 | ||
| Theoretical pI: | 11.343 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 54.685 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.507 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.164 | ||
| sheet | 0.284 | ||