| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334942.1 | 3prime_partial | 262 | 19-804(+) |
Amino Acid sequence : | |||
| MFGYATDETPYLMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEEGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVIGGPHG DAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKT AAYGHFGRDDPDFTXETVKVLK | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 12,660.246 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 37.187 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.230 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334942.1 | complete | 113 | 438-97(-) |
Amino Acid sequence : | |||
| MSTPATICVDDDLPTSETGISMWTTNHETPRWVKVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLIVLRGDEDCVNSHRNHGTFLVFVLDGDLGLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,660.246 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 37.187 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.230 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334942.1 | 3prime_partial | 262 | 19-804(+) |
Amino Acid sequence : | |||
| MFGYATDETPYLMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEEGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVIGGPHG DAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKT AAYGHFGRDDPDFTXETVKVLK | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 12,660.246 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 37.187 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.230 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334942.1 | complete | 113 | 438-97(-) |
Amino Acid sequence : | |||
| MSTPATICVDDDLPTSETGISMWTTNHETPRWVKVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLIVLRGDEDCVNSHRNHGTFLVFVLDGDLGLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,660.246 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 37.187 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.230 | ||
| sheet | 0.212 | ||