| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334971.1 | 5prime_partial | 193 | 714-133(-) |
Amino Acid sequence : | |||
| ASEQGVETVDSNVFITAENVESLNQAKDFNGVQIDYTDPAKKVEEVLVLNGATQLGTVGCVAVDGNGNLVFVPSTGGLVNKMVGRIGDTPIFGAGTYANKFCPIFATGKGEAIIRPPVGR DVAAFMEYKGLSLKEAARYVFEECAPTRTAGLVAVFVPGEVGIPFNTVGMFRACVTEDGYTEVAICPNEAFDV* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 13,835.939 | ||
| Theoretical pI: | 10.565 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 49.522 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.351 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334971.1 | complete | 134 | 206-610(+) |
Amino Acid sequence : | |||
| MPTVLNGIPTSPGTNTATKPAVRVGAHSSKTYLAASFRESPLYSIKAATSLPTGGRIMASPLPVAKMGQNLLAYVPAPKIGVSPILPTILFTNPPVDGTKTKLPFPSTATHPTVPSWVAP LRTNTSSTFLAGSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 13,835.939 | ||
| Theoretical pI: | 10.565 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 49.522 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.351 | ||
| sheet | 0.224 | ||