Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334971.1 | 5prime_partial | 193 | 714-133(-) |
Amino Acid sequence : | |||
ASEQGVETVDSNVFITAENVESLNQAKDFNGVQIDYTDPAKKVEEVLVLNGATQLGTVGCVAVDGNGNLVFVPSTGGLVNKMVGRIGDTPIFGAGTYANKFCPIFATGKGEAIIRPPVGR DVAAFMEYKGLSLKEAARYVFEECAPTRTAGLVAVFVPGEVGIPFNTVGMFRACVTEDGYTEVAICPNEAFDV* | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 13,835.939 | ||
Theoretical pI: | 10.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 49.522 | ||
aromaticity | 0.060 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.351 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334971.1 | complete | 134 | 206-610(+) |
Amino Acid sequence : | |||
MPTVLNGIPTSPGTNTATKPAVRVGAHSSKTYLAASFRESPLYSIKAATSLPTGGRIMASPLPVAKMGQNLLAYVPAPKIGVSPILPTILFTNPPVDGTKTKLPFPSTATHPTVPSWVAP LRTNTSSTFLAGSV* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 13,835.939 | ||
Theoretical pI: | 10.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 49.522 | ||
aromaticity | 0.060 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.351 | ||
sheet | 0.224 |