| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| SYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANF AAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADP FEYCDLVTTTTHKSLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | 5prime_partial | 193 | 1-582(+) |
Amino Acid sequence : | |||
| SPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLI SPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | complete | 134 | 683-279(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
| LLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| SYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANF AAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADP FEYCDLVTTTTHKSLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | 5prime_partial | 193 | 1-582(+) |
Amino Acid sequence : | |||
| SPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLI SPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | complete | 134 | 683-279(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334977.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
| LLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 14,350.574 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.092 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||