Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334981.1 | 5prime_partial | 192 | 1-579(+) |
Amino Acid sequence : | |||
ARIYYLMKILTERGYTFTTTAEREIVRDVKEKLAYVALDFEQESETAKNSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGS TMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKGEYDESGPAIVHRKCF* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,467.438 | ||
Theoretical pI: | 5.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
Instability index: | 35.255 | ||
aromaticity | 0.094 | ||
GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.214 | ||
sheet | 0.266 |