Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334983.1 | 5prime_partial | 173 | 2-523(+) |
Amino Acid sequence : | |||
HAVAATRGVAPERVVTAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLA ADKATYPKLIGLEKSRELADKLNREAKEHLLHFDPHRAAPLIALADYIAYRDY* | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,388.848 | ||
Theoretical pI: | 5.683 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 23.295 | ||
aromaticity | 0.040 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.168 | ||
sheet | 0.376 |