| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334985.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
| ARGSVLSLSSFLPSLYPRDMSSLTKPLIKNLSMATNSCLISLPPFFTTTKSMSFISTPLKPISLSSSLSLKKTTNQFPSIVSVVAALQDDDSSVGLEEKEQGGEALSFDFASVGDAGESD EAEPETEAEEYQEPPEDAKLFVGNLPYDIDSEGLAQLFQQAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEAEKAVVLYNRYDLNGRLLTVNKAARRGSQPERPPRTFQPTYRIYVGNIP WDIDDARLEQVFSEHGK | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,306.302 | ||
| Theoretical pI: | 4.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 49.114 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.344 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.276 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334985.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
| ARGSVLSLSSFLPSLYPRDMSSLTKPLIKNLSMATNSCLISLPPFFTTTKSMSFISTPLKPISLSSSLSLKKTTNQFPSIVSVVAALQDDDSSVGLEEKEQGGEALSFDFASVGDAGESD EAEPETEAEEYQEPPEDAKLFVGNLPYDIDSEGLAQLFQQAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEAEKAVVLYNRYDLNGRLLTVNKAARRGSQPERPPRTFQPTYRIYVGNIP WDIDDARLEQVFSEHGK | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,306.302 | ||
| Theoretical pI: | 4.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 49.114 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.344 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.276 | ||
| sheet | 0.272 | ||