| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334989.1 | complete | 161 | 116-601(+) |
Amino Acid sequence : | |||
| MNSDQWTQNQRFNLRDELFWFGKPRLLLRLIQFISFQNAFEMTAYLWSLWEIKASSCYTGDHTFLVIRLTFGVVSQFWCSLITFPLYVIVAQMGSKFKKTIVSENVRQSLHGWRRKVRTR HGPSSVVKVDDASLNHSQLKEEVEEELQDLVPAKSTDHHMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,980.567 | ||
| Theoretical pI: | 9.228 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37595 | ||
| Instability index: | 37.361 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.193 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334989.1 | complete | 161 | 116-601(+) |
Amino Acid sequence : | |||
| MNSDQWTQNQRFNLRDELFWFGKPRLLLRLIQFISFQNAFEMTAYLWSLWEIKASSCYTGDHTFLVIRLTFGVVSQFWCSLITFPLYVIVAQMGSKFKKTIVSENVRQSLHGWRRKVRTR HGPSSVVKVDDASLNHSQLKEEVEEELQDLVPAKSTDHHMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,980.567 | ||
| Theoretical pI: | 9.228 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37595 | ||
| Instability index: | 37.361 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.193 | ||
| sheet | 0.224 | ||