| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334991.1 | 5prime_partial | 166 | 1-501(+) |
Amino Acid sequence : | |||
| APGARQEAAAKKAAEEASKGDNGEQQATSQDTTMAENVNSGTSEPDKKTHDLMDDENALLQQALAMSMDDASSTVAVRDTDMSDASADDHDLQLALQLSVQDGQGDQSNPNDVNRLLTDQ SFVSSILASLPGVDPNDPHVKDLLASMQNQPEKKEEDKEPKEEEKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 17,820.977 | ||
| Theoretical pI: | 4.211 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 48.095 | ||
| aromaticity | 0.006 | ||
| GRAVY | -1.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.145 | ||
| turn | 0.241 | ||
| sheet | 0.325 | ||