| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334997.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
| RGMIIVVACVELCDASTVVDVYRLVQYDMAGVPFGSRLAALNHHAASSLFSSSAAAGAAADLSRTVLILPVRELNLTFIREYIEEKKPLGGLLLLLPQAFNPQNVDSKDEEGHGSAISNV KEVLLELERLLVHANIPYPVYFGFEDDHVNAVLADVRKNDATGQMATATTGGYKLVVTAPEPKKIVSPTIANIQGWLPGLRADGDSSQLPTIAVVASYDTFGAAPALSVGSDSNGSGVVA LLEISR | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 25,998.333 | ||
| Theoretical pI: | 4.981 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 41.561 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.252 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334997.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
| RGMIIVVACVELCDASTVVDVYRLVQYDMAGVPFGSRLAALNHHAASSLFSSSAAAGAAADLSRTVLILPVRELNLTFIREYIEEKKPLGGLLLLLPQAFNPQNVDSKDEEGHGSAISNV KEVLLELERLLVHANIPYPVYFGFEDDHVNAVLADVRKNDATGQMATATTGGYKLVVTAPEPKKIVSPTIANIQGWLPGLRADGDSSQLPTIAVVASYDTFGAAPALSVGSDSNGSGVVA LLEISR | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 25,998.333 | ||
| Theoretical pI: | 4.981 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 41.561 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.252 | ||
| sheet | 0.305 | ||