Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335008.1 | 5prime_partial | 192 | 2-580(+) |
Amino Acid sequence : | |||
HAVLVDQAYTKFVTIMFVTLDKIAQTDLKYQDIMLLENYASFQNSLYDLANVVPTLAKFYHQASESYEQACTRHINTIIYYQFERLFQFARRIEDLMYTITPEEIPFQIGLSKADLRKVV KYSLSGVDKSISTMYKRLQKNLASEELLPSLWDKCKKEFLEKYESFVQLINKVYPTESIPSISEMRGLLASM* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 22,431.673 | ||
Theoretical pI: | 6.369 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24870 24995 | ||
Instability index: | 47.712 | ||
aromaticity | 0.125 | ||
GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.161 | ||
sheet | 0.281 |