Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335010.1 | 5prime_partial | 175 | 2-529(+) |
Amino Acid sequence : | |||
SCCFLSQNQMDNLLGLLRIKVKRGINLAVRDVSSSDPYVIIKMAKQKLKTRVINKNVNPEWNEDLTLSITDHNLPIHLNVYDHDTFSLDDKMGDAEFDIRPFVEAVKMGLQGLPDGTIIT KVPASRSNCLSEESCVVWKDGKVVQEMCLRLRNVECGEVEIELQWINVPGSRGLF* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 14,296.053 | ||
Theoretical pI: | 9.878 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 67.620 | ||
aromaticity | 0.102 | ||
GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.339 | ||
sheet | 0.126 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335010.1 | complete | 127 | 612-229(-) |
Amino Acid sequence : | |||
MYRPHKISYNFDTYKPNSKQIQLHIKSNQNKPLEPGTLIHCSSISTSPHSTFLRRRHISCTTFPSFHTTQLSSDRQFDLEAGTFVIIVPSGSPCSPIFTASTNGLMSNSASPILSSRLKV SWSYTFR* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,296.053 | ||
Theoretical pI: | 9.878 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 67.620 | ||
aromaticity | 0.102 | ||
GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.339 | ||
sheet | 0.126 |