Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335011.1 | 5prime_partial | 174 | 719-195(-) |
Amino Acid sequence : | |||
CCFLSQNQMDNLLGLLRIKVKRGINLAVRDVSSSDPYVIIKMAKQKLKTRVINKNVNPEWNEDLTLSITDHNLPIHLNVYDHDTFSLDDKMGDAEFDIRPFVEAVKMGLQGLPDGTIITK VPASRSNCLSEESCVVWKDGKVVQEMCLRLRNVECGEVEIELQWINVPGSRGLF* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 18,620.024 | ||
Theoretical pI: | 10.023 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 66.381 | ||
aromaticity | 0.110 | ||
GRAVY | -0.309 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.317 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335011.1 | 5prime_partial | 164 | 1-495(+) |
Amino Acid sequence : | |||
DSRISMQQEVHFPKLQLAILSGFYLTLSPFSFSTLNRMYRPHKISYNFDTYKPNSKQIQLHIKSNQNKPLEPGTLIHCSSISTSPHSTFLRRRHISCTTFPSFHTTQLSSDRQFDLEAGT FVIIVPSGSPCRPIFTASTNGLMSNSASPILSSRLKVSWSYTFR* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,620.024 | ||
Theoretical pI: | 10.023 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 66.381 | ||
aromaticity | 0.110 | ||
GRAVY | -0.309 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.317 | ||
sheet | 0.152 |