Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335014.1	complete	134	51-455(+)
Amino Acid sequence :
MAAASSSTITLPFAANPSKKCTSLSSSNSVFFSSNIKNRAGLGLCVDRPIRAQKRGFSCNCLFGLGVPELVVIIGVSALVFGPKQLPEVGRSIGKTVKSFQQAAKEFETELRKDPEPSAV AVKAADEEQQQEAA*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,160.065
Theoretical pI:		9.022
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 250
Instability index:		56.700
aromaticity		0.060
GRAVY		-0.063
Secondary Structure Fraction
Helix		0.261
turn		0.284
sheet		0.269