| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335016.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
| ARRKDPDSKVACETCTLTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGA RLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAF SGKDPTKVDRSGAYIVRQ | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 14,225.649 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 21.118 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335016.1 | 5prime_partial | 140 | 774-352(-) |
Amino Acid sequence : | |||
| LPDDVGATPVDLGGVLPGEGPATVGAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDGDLGL PVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 14,225.649 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 21.118 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335016.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
| ARRKDPDSKVACETCTLTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGA RLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAF SGKDPTKVDRSGAYIVRQ | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 14,225.649 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 21.118 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335016.1 | 5prime_partial | 140 | 774-352(-) |
Amino Acid sequence : | |||
| LPDDVGATPVDLGGVLPGEGPATVGAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDGDLGL PVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 14,225.649 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 21.118 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.250 | ||