Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335020.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
SLRSLSLSTLIITLDMKGGRSKAESKKADAKLSVKKGAAAAKKPVAKKGKAAKDPNKPKRPASAFFVFMEDFRKTYKEKHPNNKSVSAVGKAGGEKWKSMSEAEKAPFVAKAEKRKAEYE KTLQAYNKKISDGAGADDESDKSKSEVNDDEDDDEEGSADDDDEDDE* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 11,053.695 | ||
Theoretical pI: | 5.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 45.688 | ||
aromaticity | 0.180 | ||
GRAVY | 0.433 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.220 | ||
sheet | 0.340 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335020.1 | 3prime_partial | 100 | 300-1(-) |
Amino Acid sequence : | |||
MDFHFSPPAFPTADTDLLFGCFSLYVFLKSSMKTKKALAGLLGLFGSLAAFPFFATGFFAAAAPFFTESLASAFFDSALDLPPFMSSVIMRVDRERERRE | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,053.695 | ||
Theoretical pI: | 5.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 45.688 | ||
aromaticity | 0.180 | ||
GRAVY | 0.433 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.220 | ||
sheet | 0.340 |