| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335028.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
| VEAAAEIFKKEGLKEEVNNVGGVDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKGWGLNLGELARIWKGGCIIRAVFLDRIKQAYQRNPGLANLLVDPEFAREMVQRQAAWRRVVG LAIQKGISVPGMSASLQYFDTYRRGRLPANLVQAQRDYFGAHTYERVDLPGSYHTEWSKLARKARV* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 11,159.815 | ||
| Theoretical pI: | 10.879 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.033 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335028.1 | complete | 100 | 487-185(-) |
Amino Acid sequence : | |||
| MSSKVVPLRLHEVSREPPTPVGIKILQTCRHSRNTNALLNGQPNNSSPRRLPLHHLPCKLWVHQQVSKARIPLISLLNPVQEHGPDNAPAFPNPSQLPQI* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,159.815 | ||
| Theoretical pI: | 10.879 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.033 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.210 | ||