| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335029.1 | 5prime_partial | 188 | 624-58(-) |
Amino Acid sequence : | |||
| HEGEAAAEIFKKEGLKEEVNNVGGVDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKGWGLNLGELAWIWKGGCIIRAVFLDRIKQAYQRNPGLGNLLVDPEFAREMVQRQAAWRRV VGLAIQKGISVPGMFASLQYFDTYRRGRLPANLVQGQRDYFGAHTYERVDFPGLYHTEWSKLACKARV* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 11,084.874 | ||
| Theoretical pI: | 11.088 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 59.605 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335029.1 | complete | 100 | 133-435(+) |
Amino Acid sequence : | |||
| MSSKVVPLPLHKVSREPPTPVGIKILQTCKHSRNTNALLNGQPNNSSPRRLPLHHLPCKLWVHQQVTKARIPLISLLNPVQKHGPDNAPAFPNPSQLPQI* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,084.874 | ||
| Theoretical pI: | 11.088 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 59.605 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335029.1 | 5prime_partial | 188 | 624-58(-) |
Amino Acid sequence : | |||
| HEGEAAAEIFKKEGLKEEVNNVGGVDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKGWGLNLGELAWIWKGGCIIRAVFLDRIKQAYQRNPGLGNLLVDPEFAREMVQRQAAWRRV VGLAIQKGISVPGMFASLQYFDTYRRGRLPANLVQGQRDYFGAHTYERVDFPGLYHTEWSKLACKARV* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 11,084.874 | ||
| Theoretical pI: | 11.088 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 59.605 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335029.1 | complete | 100 | 133-435(+) |
Amino Acid sequence : | |||
| MSSKVVPLPLHKVSREPPTPVGIKILQTCKHSRNTNALLNGQPNNSSPRRLPLHHLPCKLWVHQQVTKARIPLISLLNPVQKHGPDNAPAFPNPSQLPQI* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,084.874 | ||
| Theoretical pI: | 11.088 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 59.605 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.190 | ||