| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335034.1 | complete | 140 | 30-452(+) |
Amino Acid sequence : | |||
| MSKRGRGGTAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP IGKECADLWPRIASAANAIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,028.666 | ||
| Theoretical pI: | 10.480 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 31.070 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.271 | ||
| sheet | 0.229 | ||