Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335035.1 | complete | 140 | 549-127(-) |
Amino Acid sequence : | |||
MLKRGRGGTAGNKFRMSLGLPVAATVKCADNTGAKNLSIISVKGIKGRFNRLPSACVGDMVMAPVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP IGKECADLWPRIASAANAIV* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 13,568.932 | ||
Theoretical pI: | 11.654 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 64.370 | ||
aromaticity | 0.123 | ||
GRAVY | 0.179 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.270 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335035.1 | complete | 122 | 200-568(+) |
Amino Acid sequence : | |||
MADPFISPLGLTMTPALSSKYMKTPSFRRQGLRWRTMTAGITFLRKSGFPFFTGAITMSPTQADGSLLKRPLIPLTDMMERFLAPVLSAHFTVAATGRPSDILNLFPAVPPRPRFNIFGF FL* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,568.932 | ||
Theoretical pI: | 11.654 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 64.370 | ||
aromaticity | 0.123 | ||
GRAVY | 0.179 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.270 | ||
sheet | 0.262 |