| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335037.1 | 5prime_partial | 125 | 1-378(+) |
Amino Acid sequence : | |||
| PMHDPILPSKIVSQIDYYFSNENLVKDIFLRQNMDGEGWVSIKLIAGFKKVMQLTDNIQLILDAIKVSNVVEVQGDKVRRKNDWMKWIMSPVQNSVMSPPSMNISGQNMLAAHFNNVTLD EKAAI* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,203.366 | ||
| Theoretical pI: | 7.296 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 47.230 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.143 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.256 | ||
| sheet | 0.216 | ||