Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335037.1 | 5prime_partial | 125 | 1-378(+) |
Amino Acid sequence : | |||
PMHDPILPSKIVSQIDYYFSNENLVKDIFLRQNMDGEGWVSIKLIAGFKKVMQLTDNIQLILDAIKVSNVVEVQGDKVRRKNDWMKWIMSPVQNSVMSPPSMNISGQNMLAAHFNNVTLD EKAAI* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,203.366 | ||
Theoretical pI: | 7.296 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 47.230 | ||
aromaticity | 0.072 | ||
GRAVY | -0.143 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.256 | ||
sheet | 0.216 |