| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335040.1 | internal | 271 | 3-815(+) |
Amino Acid sequence : | |||
| IILKPQPYLQYLVIAMCASGNLGNIMVILIPAMCEEEGNPFGDRETCRSIGLSYASLSMALGCLYMWTYTYHLIQSSSVIYRATLPPSEVPPKEANKDLEASGEAALLVHSSDADADTAN RHNTRPSAAVWTQLVGVSRQILEELKAPPVVAAFFGFVFGAVSWLRNIVIGDNAPLKVVNDSITVIGEATIPCINLILGGNLTQGFNKSKMEPKLAIAVIVVRYMLLPGLGIGVVKGASY LGLLPSDPLFHFVLMIQYTLPPAMNIGTMTQ | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 12,975.843 | ||
| Theoretical pI: | 9.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 53.946 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.344 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335040.1 | complete | 122 | 766-398(-) |
Amino Acid sequence : | |||
| MSTKWNRGSEGRSPKYEAPLTTPIPSPGSNMYLTTITAIASFGSIFDLLKPCVRLPPRMRLIQGMVASPITVIESFTTLRGALSPITMFLSQETAPNTNPKNAATTGGALSSSNICLETP TS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 12,975.843 | ||
| Theoretical pI: | 9.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 53.946 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.344 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335040.1 | internal | 271 | 3-815(+) |
Amino Acid sequence : | |||
| IILKPQPYLQYLVIAMCASGNLGNIMVILIPAMCEEEGNPFGDRETCRSIGLSYASLSMALGCLYMWTYTYHLIQSSSVIYRATLPPSEVPPKEANKDLEASGEAALLVHSSDADADTAN RHNTRPSAAVWTQLVGVSRQILEELKAPPVVAAFFGFVFGAVSWLRNIVIGDNAPLKVVNDSITVIGEATIPCINLILGGNLTQGFNKSKMEPKLAIAVIVVRYMLLPGLGIGVVKGASY LGLLPSDPLFHFVLMIQYTLPPAMNIGTMTQ | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 12,975.843 | ||
| Theoretical pI: | 9.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 53.946 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.344 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335040.1 | complete | 122 | 766-398(-) |
Amino Acid sequence : | |||
| MSTKWNRGSEGRSPKYEAPLTTPIPSPGSNMYLTTITAIASFGSIFDLLKPCVRLPPRMRLIQGMVASPITVIESFTTLRGALSPITMFLSQETAPNTNPKNAATTGGALSSSNICLETP TS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 12,975.843 | ||
| Theoretical pI: | 9.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 53.946 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.344 | ||
| sheet | 0.246 | ||